Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,707
  2. Avatar for Go Science 2. Go Science 74 pts. 10,647
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,603
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,542
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,430
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 18 pts. 10,347
  7. Avatar for Contenders 7. Contenders 12 pts. 10,335
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,317
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,156
  10. Avatar for Deleted group 10. Deleted group pts. 9,146

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 52 pts. 10,271
  2. Avatar for Blipperman 22. Blipperman Lv 1 50 pts. 10,249
  3. Avatar for dizzywings 23. dizzywings Lv 1 49 pts. 10,221
  4. Avatar for eusair 24. eusair Lv 1 47 pts. 10,209
  5. Avatar for caglar 25. caglar Lv 1 45 pts. 10,207
  6. Avatar for robgee 26. robgee Lv 1 44 pts. 10,185
  7. Avatar for O Seki To 27. O Seki To Lv 1 42 pts. 10,156
  8. Avatar for pvc78 28. pvc78 Lv 1 41 pts. 10,152
  9. Avatar for georg137 29. georg137 Lv 1 39 pts. 10,145
  10. Avatar for Maerlyn138 30. Maerlyn138 Lv 1 38 pts. 10,142

Comments