Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,707
  2. Avatar for Go Science 2. Go Science 74 pts. 10,647
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,603
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,542
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,430
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 18 pts. 10,347
  7. Avatar for Contenders 7. Contenders 12 pts. 10,335
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,317
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,156
  10. Avatar for Deleted group 10. Deleted group pts. 9,146
  1. Avatar for Alexei2511 111. Alexei2511 Lv 1 1 pt. 8,172
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 8,165
  3. Avatar for kyky 113. kyky Lv 1 1 pt. 8,156
  4. Avatar for Pauling 114. Pauling Lv 1 1 pt. 8,088
  5. Avatar for west.elsdon 115. west.elsdon Lv 1 1 pt. 8,011
  6. Avatar for exploren 116. exploren Lv 1 1 pt. 7,840
  7. Avatar for atlas100 117. atlas100 Lv 1 1 pt. 7,828
  8. Avatar for Sydefecks 118. Sydefecks Lv 1 1 pt. 7,825
  9. Avatar for NotJim99 119. NotJim99 Lv 1 1 pt. 7,818
  10. Avatar for bzipitidoo 120. bzipitidoo Lv 1 1 pt. 7,813

Comments