Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,853
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,637
  1. Avatar for 181818 81. 181818 Lv 1 2 pts. 9,190
  2. Avatar for smilingone 82. smilingone Lv 1 2 pts. 9,185
  3. Avatar for carinita 83. carinita Lv 1 2 pts. 9,173
  4. Avatar for boondog 84. boondog Lv 1 2 pts. 9,154
  5. Avatar for pfeiffelfloyd 85. pfeiffelfloyd Lv 1 2 pts. 9,141
  6. Avatar for bhfreagra 86. bhfreagra Lv 1 1 pt. 9,110
  7. Avatar for cobaltteal 87. cobaltteal Lv 1 1 pt. 9,057
  8. Avatar for toshiue 88. toshiue Lv 1 1 pt. 9,053
  9. Avatar for frostschutz 89. frostschutz Lv 1 1 pt. 9,049
  10. Avatar for Psych0Active 90. Psych0Active Lv 1 1 pt. 9,045

Comments