Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 6 pts. 10,083
  2. Avatar for reefyrob 12. reefyrob Lv 1 4 pts. 10,025
  3. Avatar for Alistair69 13. Alistair69 Lv 1 3 pts. 10,017
  4. Avatar for smilingone 14. smilingone Lv 1 2 pts. 10,001
  5. Avatar for Galaxie 15. Galaxie Lv 1 1 pt. 9,977
  6. Avatar for Deleted player 16. Deleted player pts. 9,971
  7. Avatar for phi16 17. phi16 Lv 1 1 pt. 9,969
  8. Avatar for lamoille 18. lamoille Lv 1 1 pt. 9,966
  9. Avatar for jamiexq 19. jamiexq Lv 1 1 pt. 9,948
  10. Avatar for alwen 20. alwen Lv 1 1 pt. 9,936

Comments