Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023

  1. Avatar for Rendier25 131. Rendier25 Lv 1 1 pt. 8,571
  2. Avatar for alyssajoyh 132. alyssajoyh Lv 1 1 pt. 8,487
  3. Avatar for Gahmeir 133. Gahmeir Lv 1 1 pt. 8,285
  4. Avatar for 01010011111 134. 01010011111 Lv 1 1 pt. 8,077
  5. Avatar for Susume 135. Susume Lv 1 1 pt. 4,077
  6. Avatar for joshmiller 136. joshmiller Lv 1 1 pt. 2,942
  7. Avatar for Uttkarsh 137. Uttkarsh Lv 1 1 pt. 2,942
  8. Avatar for baiyuncanggou 138. baiyuncanggou Lv 1 1 pt. 2,942
  9. Avatar for ghiggins 139. ghiggins Lv 1 1 pt. 2,942
  10. Avatar for leon1573 140. leon1573 Lv 1 1 pt. 2,942

Comments