Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023

  1. Avatar for TastyMunchies 41. TastyMunchies Lv 1 19 pts. 9,656
  2. Avatar for FillmoreLove 42. FillmoreLove Lv 1 18 pts. 9,638
  3. Avatar for hpaege 43. hpaege Lv 1 17 pts. 9,627
  4. Avatar for katling 44. katling Lv 1 16 pts. 9,589
  5. Avatar for Alistair69 45. Alistair69 Lv 1 16 pts. 9,587
  6. Avatar for hada 46. hada Lv 1 15 pts. 9,574
  7. Avatar for christioanchauvin 47. christioanchauvin Lv 1 14 pts. 9,570
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 13 pts. 9,565
  9. Avatar for guineapig 49. guineapig Lv 1 13 pts. 9,564
  10. Avatar for Pyotr 50. Pyotr Lv 1 12 pts. 9,564

Comments