Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886
  1. Avatar for Dranon 91. Dranon Lv 1 1 pt. 8,588
  2. Avatar for parsnip 92. parsnip Lv 1 1 pt. 8,571
  3. Avatar for nettieboo 93. nettieboo Lv 1 1 pt. 8,514
  4. Avatar for lamoille 94. lamoille Lv 1 1 pt. 8,493
  5. Avatar for Savas 95. Savas Lv 1 1 pt. 8,481
  6. Avatar for TheStaticSloth 96. TheStaticSloth Lv 1 1 pt. 8,463
  7. Avatar for jamiexq 97. jamiexq Lv 1 1 pt. 8,436
  8. Avatar for alyssa_d 98. alyssa_d Lv 1 1 pt. 8,188
  9. Avatar for Deleted player 99. Deleted player pts. 8,116
  10. Avatar for TY2017 100. TY2017 Lv 1 1 pt. 7,900

Comments