Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886

  1. Avatar for JRRidder 111. JRRidder Lv 1 1 pt. 6,068
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 5,628
  3. Avatar for CMmartinez 113. CMmartinez Lv 1 1 pt. 5,624
  4. Avatar for Wondry 114. Wondry Lv 1 1 pt. 5,272
  5. Avatar for jflat06 115. jflat06 Lv 1 1 pt. 4,886
  6. Avatar for bobbbob 116. bobbbob Lv 1 1 pt. 0
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 0
  8. Avatar for joshmiller 118. joshmiller Lv 1 1 pt. 0
  9. Avatar for multaq 119. multaq Lv 1 1 pt. 0
  10. Avatar for xabxs 120. xabxs Lv 1 1 pt. 0

Comments