Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886
  1. Avatar for Hollinas 121. Hollinas Lv 1 1 pt. 0
  2. Avatar for devjosh 122. devjosh Lv 1 1 pt. 0
  3. Avatar for MayPeda2018 123. MayPeda2018 Lv 1 1 pt. 0
  4. Avatar for Matthew Hantsbarger 124. Matthew Hantsbarger Lv 1 1 pt. 0
  5. Avatar for xabxs 125. xabxs Lv 1 1 pt. 0
  6. Avatar for ManVsYard 126. ManVsYard Lv 1 1 pt. 0

Comments