Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886
  1. Avatar for baiyuncanggou 121. baiyuncanggou Lv 1 1 pt. 0
  2. Avatar for Susume 122. Susume Lv 1 1 pt. 0
  3. Avatar for Hollinas 123. Hollinas Lv 1 1 pt. 0
  4. Avatar for devjosh 124. devjosh Lv 1 1 pt. 0
  5. Avatar for MayPeda2018 125. MayPeda2018 Lv 1 1 pt. 0
  6. Avatar for Matthew Hantsbarger 126. Matthew Hantsbarger Lv 1 1 pt. 0

Comments