Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 15 pts. 9,795
  2. Avatar for manu8170 42. manu8170 Lv 1 14 pts. 9,777
  3. Avatar for katling 43. katling Lv 1 13 pts. 9,765
  4. Avatar for JMStiffler 44. JMStiffler Lv 1 13 pts. 9,716
  5. Avatar for erikviking 45. erikviking Lv 1 12 pts. 9,713
  6. Avatar for spvincent 46. spvincent Lv 1 11 pts. 9,708
  7. Avatar for heather-1 47. heather-1 Lv 1 11 pts. 9,702
  8. Avatar for alcor29 48. alcor29 Lv 1 10 pts. 9,685
  9. Avatar for ViJay7019 49. ViJay7019 Lv 1 9 pts. 9,663
  10. Avatar for jobo0502 50. jobo0502 Lv 1 9 pts. 9,663

Comments