Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886

  1. Avatar for Superphosphate 61. Superphosphate Lv 1 4 pts. 9,339
  2. Avatar for Vincera 62. Vincera Lv 1 4 pts. 9,323
  3. Avatar for pfirth 63. pfirth Lv 1 4 pts. 9,299
  4. Avatar for weitzen 64. weitzen Lv 1 4 pts. 9,297
  5. Avatar for pfeiffelfloyd 65. pfeiffelfloyd Lv 1 3 pts. 9,275
  6. Avatar for SaraL 66. SaraL Lv 1 3 pts. 9,272
  7. Avatar for rabamino12358 67. rabamino12358 Lv 1 3 pts. 9,271
  8. Avatar for Deleted player 68. Deleted player pts. 9,248
  9. Avatar for carinita 69. carinita Lv 1 2 pts. 9,245
  10. Avatar for hada 70. hada Lv 1 2 pts. 9,230

Comments