Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886

  1. Avatar for lconor 81. lconor Lv 1 1 pt. 9,033
  2. Avatar for abiogenesis 82. abiogenesis Lv 1 1 pt. 9,032
  3. Avatar for Pibeagles 83. Pibeagles Lv 1 1 pt. 9,025
  4. Avatar for rezaefar 84. rezaefar Lv 1 1 pt. 8,931
  5. Avatar for Knoblerine 85. Knoblerine Lv 1 1 pt. 8,880
  6. Avatar for KnaveErrant 86. KnaveErrant Lv 1 1 pt. 8,812
  7. Avatar for Palenta 87. Palenta Lv 1 1 pt. 8,778
  8. Avatar for Datstandin 88. Datstandin Lv 1 1 pt. 8,767
  9. Avatar for rinze 89. rinze Lv 1 1 pt. 8,740
  10. Avatar for dbuske 90. dbuske Lv 1 1 pt. 8,723

Comments