Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481

  1. Avatar for ViJay7019 11. ViJay7019 Lv 1 2 pts. 10,546
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 1 pt. 10,541
  3. Avatar for Deleted player 13. Deleted player pts. 10,537
  4. Avatar for actiasluna 14. actiasluna Lv 1 1 pt. 10,537
  5. Avatar for ManVsYard 15. ManVsYard Lv 1 1 pt. 10,515
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 1 pt. 10,514
  7. Avatar for Vincera 17. Vincera Lv 1 1 pt. 10,417
  8. Avatar for jausmh 18. jausmh Lv 1 1 pt. 10,321
  9. Avatar for Museka 19. Museka Lv 1 1 pt. 6,751

Comments