Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,680
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 10,650
  3. Avatar for grogar7 3. grogar7 Lv 1 93 pts. 10,641
  4. Avatar for eusair 4. eusair Lv 1 89 pts. 10,630
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 85 pts. 10,623
  6. Avatar for phi16 6. phi16 Lv 1 82 pts. 10,619
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 79 pts. 10,558
  8. Avatar for Enzyme 8. Enzyme Lv 1 75 pts. 10,522
  9. Avatar for LociOiling 9. LociOiling Lv 1 72 pts. 10,508
  10. Avatar for reefyrob 10. reefyrob Lv 1 69 pts. 10,490

Comments