Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 11,691
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 97 pts. 11,669
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 11,667
  4. Avatar for Enzyme 4. Enzyme Lv 1 89 pts. 11,664
  5. Avatar for LociOiling 5. LociOiling Lv 1 86 pts. 11,643
  6. Avatar for eusair 6. eusair Lv 1 83 pts. 11,635
  7. Avatar for johnmitch 7. johnmitch Lv 1 79 pts. 11,628
  8. Avatar for phi16 8. phi16 Lv 1 76 pts. 11,620
  9. Avatar for TastyMunchies 9. TastyMunchies Lv 1 73 pts. 11,618
  10. Avatar for frood66 10. frood66 Lv 1 70 pts. 11,607

Comments