Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,700
  2. Avatar for LociOiling 2. LociOiling Lv 1 71 pts. 11,672
  3. Avatar for toshiue 3. toshiue Lv 1 49 pts. 11,668
  4. Avatar for reefyrob 4. reefyrob Lv 1 33 pts. 11,654
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 22 pts. 11,648
  6. Avatar for sciencewalker 6. sciencewalker Lv 1 14 pts. 11,641
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 8 pts. 11,633
  8. Avatar for alwen 8. alwen Lv 1 5 pts. 11,623
  9. Avatar for phi16 9. phi16 Lv 1 3 pts. 11,622
  10. Avatar for jausmh 10. jausmh Lv 1 2 pts. 11,583

Comments