Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,700
  2. Avatar for LociOiling 2. LociOiling Lv 1 71 pts. 11,672
  3. Avatar for toshiue 3. toshiue Lv 1 49 pts. 11,668
  4. Avatar for reefyrob 4. reefyrob Lv 1 33 pts. 11,654
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 22 pts. 11,648
  6. Avatar for sciencewalker 6. sciencewalker Lv 1 14 pts. 11,641
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 8 pts. 11,633
  8. Avatar for alwen 8. alwen Lv 1 5 pts. 11,623
  9. Avatar for phi16 9. phi16 Lv 1 3 pts. 11,622
  10. Avatar for jausmh 10. jausmh Lv 1 2 pts. 11,583

Comments