Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061

  1. Avatar for hpaege 11. hpaege Lv 1 67 pts. 11,606
  2. Avatar for erikviking 12. erikviking Lv 1 65 pts. 11,586
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 62 pts. 11,563
  4. Avatar for O Seki To 14. O Seki To Lv 1 59 pts. 11,550
  5. Avatar for Aubade01 15. Aubade01 Lv 1 57 pts. 11,543
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 54 pts. 11,529
  7. Avatar for nicobul 17. nicobul Lv 1 52 pts. 11,523
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 50 pts. 11,518
  9. Avatar for reefyrob 19. reefyrob Lv 1 48 pts. 11,510
  10. Avatar for grogar7 20. grogar7 Lv 1 46 pts. 11,506

Comments