Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061

  1. Avatar for weitzen 61. weitzen Lv 1 5 pts. 10,918
  2. Avatar for Glen B 62. Glen B Lv 1 5 pts. 10,864
  3. Avatar for drjr 63. drjr Lv 1 4 pts. 10,760
  4. Avatar for rezaefar 64. rezaefar Lv 1 4 pts. 10,734
  5. Avatar for diamonddays 65. diamonddays Lv 1 4 pts. 10,710
  6. Avatar for The_Otterable 66. The_Otterable Lv 1 4 pts. 10,656
  7. Avatar for Savas 67. Savas Lv 1 3 pts. 10,648
  8. Avatar for hada 68. hada Lv 1 3 pts. 10,633
  9. Avatar for khendarg 69. khendarg Lv 1 3 pts. 10,617
  10. Avatar for dalber 70. dalber Lv 1 3 pts. 10,614

Comments