Placeholder image of a protein
Icon representing a puzzle

1516: Foldit Player Design with Electron Density

Closed since almost 8 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
May 02, 2018
Expires
Max points
100
Description

This puzzle features a protein designed by fiendish_ghoul in Puzzle 1331! Last week, we challenged players to try to predict the structure of this protein from the sequence alone, in Puzzle 1511. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map at a resolution of 1.54 Å. The crystal's electron density shows that this protein folds up exactly as fiendish_ghoul designed it, with RMSD of 0.9 Å among Cα atoms! Players can load in solutions from Puzzle 1511 to see how their predictions fit in the electron density map, or players can try building into the electron density from an extended chain.



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 10,150
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,523

  1. Avatar for Hollinas 112. Hollinas Lv 1 1 pt. 0
  2. Avatar for altejoh 114. altejoh Lv 1 1 pt. 0
  3. Avatar for vbj2 17 115. vbj2 17 Lv 1 1 pt. 0
  4. Avatar for Keresto 116. Keresto Lv 1 1 pt. 0
  5. Avatar for multaq 117. multaq Lv 1 1 pt. 0
  6. Avatar for ManVsYard 118. ManVsYard Lv 1 1 pt. 0
  7. Avatar for joshmiller 119. joshmiller Lv 1 1 pt. 0
  8. Avatar for Idiotboy 120. Idiotboy Lv 1 1 pt. 0

Comments