Placeholder image of a protein
Icon representing a puzzle

1516: Foldit Player Design with Electron Density

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
May 02, 2018
Expires
Max points
100
Description

This puzzle features a protein designed by fiendish_ghoul in Puzzle 1331! Last week, we challenged players to try to predict the structure of this protein from the sequence alone, in Puzzle 1511. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map at a resolution of 1.54 Å. The crystal's electron density shows that this protein folds up exactly as fiendish_ghoul designed it, with RMSD of 0.9 Å among Cα atoms! Players can load in solutions from Puzzle 1511 to see how their predictions fit in the electron density map, or players can try building into the electron density from an extended chain.



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Go Science 100 pts. 15,136
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 15,126
  3. Avatar for Gargleblasters 3. Gargleblasters 37 pts. 15,097
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 15,087
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 15,014
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 13,723
  7. Avatar for Contenders 7. Contenders 2 pts. 13,334
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 12,270
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,818
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 10,468

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 15,132
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 15,128
  3. Avatar for bertro 3. bertro Lv 1 93 pts. 15,122
  4. Avatar for isaksson 4. isaksson Lv 1 89 pts. 15,116
  5. Avatar for LociOiling 5. LociOiling Lv 1 85 pts. 15,115
  6. Avatar for Enzyme 6. Enzyme Lv 1 82 pts. 15,097
  7. Avatar for pvc78 7. pvc78 Lv 1 78 pts. 15,093
  8. Avatar for reefyrob 8. reefyrob Lv 1 75 pts. 15,091
  9. Avatar for Galaxie 9. Galaxie Lv 1 72 pts. 15,084
  10. Avatar for guineapig 10. guineapig Lv 1 69 pts. 15,078

Comments