1516: Foldit Player Design with Electron Density
Closed since almost 8 years ago
Intermediate Overall Prediction Electron DensitySummary
- Created
- May 02, 2018
- Expires
- Max points
- 100
This puzzle features a protein designed by fiendish_ghoul in Puzzle 1331! Last week, we challenged players to try to predict the structure of this protein from the sequence alone, in Puzzle 1511. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map at a resolution of 1.54 Å. The crystal's electron density shows that this protein folds up exactly as fiendish_ghoul designed it, with RMSD of 0.9 Å among Cα atoms! Players can load in solutions from Puzzle 1511 to see how their predictions fit in the electron density map, or players can try building into the electron density from an extended chain.
Sequence:
GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE
