Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,253
  2. Avatar for robgee 2. robgee Lv 1 83 pts. 11,251
  3. Avatar for phi16 3. phi16 Lv 1 69 pts. 11,247
  4. Avatar for smilingone 4. smilingone Lv 1 56 pts. 11,243
  5. Avatar for LociOiling 5. LociOiling Lv 1 45 pts. 11,243
  6. Avatar for reefyrob 6. reefyrob Lv 1 36 pts. 11,235
  7. Avatar for lamoille 7. lamoille Lv 1 29 pts. 11,195
  8. Avatar for dbuske 8. dbuske Lv 1 23 pts. 11,181
  9. Avatar for alcor29 9. alcor29 Lv 1 18 pts. 11,177
  10. Avatar for alwen 10. alwen Lv 1 14 pts. 11,176

Comments