Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163

  1. Avatar for phi16
    1. phi16 Lv 1
    100 pts. 11,252
  2. Avatar for bertro 2. bertro Lv 1 97 pts. 11,234
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 11,186
  4. Avatar for reefyrob 4. reefyrob Lv 1 91 pts. 11,176
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 88 pts. 11,169
  6. Avatar for Aubade01 6. Aubade01 Lv 1 85 pts. 11,164
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 82 pts. 11,140
  8. Avatar for pvc78 8. pvc78 Lv 1 79 pts. 11,137
  9. Avatar for AtOneMent 9. AtOneMent Lv 1 76 pts. 11,134
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 73 pts. 11,124

Comments