Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for dbuske 91. dbuske Lv 1 1 pt. 9,655
  2. Avatar for gstelle 92. gstelle Lv 1 1 pt. 9,622
  3. Avatar for Savas 93. Savas Lv 1 1 pt. 9,572
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 1 pt. 9,536
  5. Avatar for Knoblerine 95. Knoblerine Lv 1 1 pt. 9,530
  6. Avatar for west.elsdon 96. west.elsdon Lv 1 1 pt. 9,437
  7. Avatar for Museka 97. Museka Lv 1 1 pt. 9,040
  8. Avatar for andrewxc 98. andrewxc Lv 1 1 pt. 9,014
  9. Avatar for Sinoson 99. Sinoson Lv 1 1 pt. 8,954
  10. Avatar for NetrPickl 100. NetrPickl Lv 1 1 pt. 8,746

Comments