Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for Kevin76 101. Kevin76 Lv 1 1 pt. 8,508
  2. Avatar for frostschutz 102. frostschutz Lv 1 1 pt. 8,351
  3. Avatar for Deleted player 103. Deleted player pts. 8,332
  4. Avatar for roman madala 104. roman madala Lv 1 1 pt. 8,251
  5. Avatar for Hollinas 105. Hollinas Lv 1 1 pt. 8,177
  6. Avatar for martinf 106. martinf Lv 1 1 pt. 8,157
  7. Avatar for ryoken329 107. ryoken329 Lv 1 1 pt. 8,139
  8. Avatar for heather-1 108. heather-1 Lv 1 1 pt. 7,750
  9. Avatar for Superphosphate 109. Superphosphate Lv 1 1 pt. 7,342
  10. Avatar for atlas100 110. atlas100 Lv 1 1 pt. 7,267

Comments