Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for lamoille 121. lamoille Lv 1 1 pt. 6,563
  2. Avatar for polymorphicchanges 122. polymorphicchanges Lv 1 1 pt. 6,536
  3. Avatar for vbj2 17 123. vbj2 17 Lv 1 1 pt. 6,531
  4. Avatar for abiogenesis 124. abiogenesis Lv 1 1 pt. 6,423
  5. Avatar for LynnM 125. LynnM Lv 1 1 pt. 6,337
  6. Avatar for irenagrocka 126. irenagrocka Lv 1 1 pt. 6,328
  7. Avatar for ac281201 127. ac281201 Lv 1 1 pt. 6,310
  8. Avatar for AstroA 128. AstroA Lv 1 1 pt. 6,302
  9. Avatar for otong1 129. otong1 Lv 1 1 pt. 6,280
  10. Avatar for aspadistra 130. aspadistra Lv 1 1 pt. 6,234

Comments