Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for larry25427 131. larry25427 Lv 1 1 pt. 6,210
  2. Avatar for alyssa_d 132. alyssa_d Lv 1 1 pt. 6,163
  3. Avatar for Palenta 133. Palenta Lv 1 1 pt. 6,085
  4. Avatar for alyssajoyh 134. alyssajoyh Lv 1 1 pt. 5,945
  5. Avatar for toshifumi yui 135. toshifumi yui Lv 1 1 pt. 5,897
  6. Avatar for SaraL 136. SaraL Lv 1 1 pt. 5,773
  7. Avatar for Wendy.E 137. Wendy.E Lv 1 1 pt. 5,329
  8. Avatar for Matthew Hantsbarger 138. Matthew Hantsbarger Lv 1 1 pt. 4,653
  9. Avatar for gaving1 139. gaving1 Lv 1 1 pt. 4,005
  10. Avatar for TheStaticSloth 140. TheStaticSloth Lv 1 1 pt. 3,816

Comments