Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for TastyMunchies 11. TastyMunchies Lv 1 71 pts. 11,116
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 68 pts. 11,115
  3. Avatar for actiasluna 13. actiasluna Lv 1 66 pts. 11,102
  4. Avatar for pauldunn 14. pauldunn Lv 1 63 pts. 11,096
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 61 pts. 11,087
  6. Avatar for Enzyme 16. Enzyme Lv 1 59 pts. 11,082
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 56 pts. 11,051
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 54 pts. 11,035
  9. Avatar for O Seki To 19. O Seki To Lv 1 52 pts. 11,035
  10. Avatar for guineapig 20. guineapig Lv 1 50 pts. 11,032

Comments