Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for Galaxie 21. Galaxie Lv 1 48 pts. 11,031
  2. Avatar for frood66 22. frood66 Lv 1 47 pts. 11,027
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 45 pts. 11,008
  4. Avatar for Blipperman 24. Blipperman Lv 1 43 pts. 11,002
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 41 pts. 10,994
  6. Avatar for drjr 26. drjr Lv 1 40 pts. 10,992
  7. Avatar for Crossed Sticks 27. Crossed Sticks Lv 1 38 pts. 10,978
  8. Avatar for mirp 28. mirp Lv 1 36 pts. 10,973
  9. Avatar for jobo0502 29. jobo0502 Lv 1 35 pts. 10,947
  10. Avatar for altejoh 30. altejoh Lv 1 34 pts. 10,943

Comments