Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for johnmitch 31. johnmitch Lv 1 32 pts. 10,942
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 31 pts. 10,920
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 30 pts. 10,900
  4. Avatar for jausmh 34. jausmh Lv 1 28 pts. 10,896
  5. Avatar for diamonddays 35. diamonddays Lv 1 27 pts. 10,896
  6. Avatar for MicElephant 36. MicElephant Lv 1 26 pts. 10,858
  7. Avatar for SWR_DMaster 37. SWR_DMaster Lv 1 25 pts. 10,854
  8. Avatar for ManVsYard 38. ManVsYard Lv 1 24 pts. 10,848
  9. Avatar for gdnskye 39. gdnskye Lv 1 23 pts. 10,845
  10. Avatar for stomjoh 40. stomjoh Lv 1 22 pts. 10,814

Comments