Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for weitzen 51. weitzen Lv 1 13 pts. 10,636
  2. Avatar for erikviking 52. erikviking Lv 1 12 pts. 10,602
  3. Avatar for leehaggis 53. leehaggis Lv 1 12 pts. 10,601
  4. Avatar for joremen 54. joremen Lv 1 11 pts. 10,580
  5. Avatar for Threeoak 55. Threeoak Lv 1 10 pts. 10,502
  6. Avatar for alwen 56. alwen Lv 1 10 pts. 10,493
  7. Avatar for johngran 57. johngran Lv 1 9 pts. 10,485
  8. Avatar for silent gene 58. silent gene Lv 1 9 pts. 10,482
  9. Avatar for Alistair69 59. Alistair69 Lv 1 8 pts. 10,477
  10. Avatar for Glen B 60. Glen B Lv 1 8 pts. 10,463

Comments