Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 8 pts. 10,455
  2. Avatar for Altercomp 62. Altercomp Lv 1 7 pts. 10,444
  3. Avatar for Deleted player 63. Deleted player pts. 10,440
  4. Avatar for DoctorSockrates 64. DoctorSockrates Lv 1 6 pts. 10,429
  5. Avatar for eusair 65. eusair Lv 1 6 pts. 10,406
  6. Avatar for mitarcher 66. mitarcher Lv 1 6 pts. 10,376
  7. Avatar for Deleted player 67. Deleted player pts. 10,375
  8. Avatar for froggs554 68. froggs554 Lv 1 5 pts. 10,365
  9. Avatar for rezaefar 69. rezaefar Lv 1 5 pts. 10,358
  10. Avatar for ourtown 70. ourtown Lv 1 5 pts. 10,348

Comments