Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 4 pts. 10,307
  2. Avatar for manu8170 72. manu8170 Lv 1 4 pts. 10,276
  3. Avatar for versat82 73. versat82 Lv 1 4 pts. 10,225
  4. Avatar for sciencewalker 74. sciencewalker Lv 1 4 pts. 10,188
  5. Avatar for toshiue 75. toshiue Lv 1 3 pts. 10,174
  6. Avatar for Hiro Protagonist 76. Hiro Protagonist Lv 1 3 pts. 10,155
  7. Avatar for kyoota 77. kyoota Lv 1 3 pts. 10,151
  8. Avatar for Psych0Active 78. Psych0Active Lv 1 3 pts. 10,146
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 3 pts. 10,100
  10. Avatar for SouperGenious 80. SouperGenious Lv 1 3 pts. 10,097

Comments