Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for Merf 81. Merf Lv 1 2 pts. 10,028
  2. Avatar for nicobul 82. nicobul Lv 1 2 pts. 9,992
  3. Avatar for anaserra 83. anaserra Lv 1 2 pts. 9,968
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 2 pts. 9,952
  5. Avatar for KnaveErrant 85. KnaveErrant Lv 1 2 pts. 9,931
  6. Avatar for rinze 86. rinze Lv 1 2 pts. 9,873
  7. Avatar for multaq 87. multaq Lv 1 2 pts. 9,836
  8. Avatar for hada 88. hada Lv 1 2 pts. 9,811
  9. Avatar for Squirrely 89. Squirrely Lv 1 1 pt. 9,802
  10. Avatar for pfeiffelfloyd 90. pfeiffelfloyd Lv 1 1 pt. 9,712

Comments