Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,253
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,243
  3. Avatar for Go Science 3. Go Science 52 pts. 11,169
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 11,113
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 11,087
  6. Avatar for Contenders 6. Contenders 16 pts. 11,051
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,041
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 11,035
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,008
  10. Avatar for freefolder 10. freefolder 2 pts. 10,444

  1. Avatar for dbuske 91. dbuske Lv 1 1 pt. 9,655
  2. Avatar for gstelle 92. gstelle Lv 1 1 pt. 9,622
  3. Avatar for Savas 93. Savas Lv 1 1 pt. 9,572
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 1 pt. 9,536
  5. Avatar for Knoblerine 95. Knoblerine Lv 1 1 pt. 9,530
  6. Avatar for west.elsdon 96. west.elsdon Lv 1 1 pt. 9,437
  7. Avatar for Museka 97. Museka Lv 1 1 pt. 9,040
  8. Avatar for andrewxc 98. andrewxc Lv 1 1 pt. 9,014
  9. Avatar for Sinoson 99. Sinoson Lv 1 1 pt. 8,954
  10. Avatar for NetrPickl 100. NetrPickl Lv 1 1 pt. 8,746

Comments