Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,253
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,243
  3. Avatar for Go Science 3. Go Science 52 pts. 11,169
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 11,113
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 11,087
  6. Avatar for Contenders 6. Contenders 16 pts. 11,051
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,041
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 11,035
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,008
  10. Avatar for freefolder 10. freefolder 2 pts. 10,444

  1. Avatar for larry25427 131. larry25427 Lv 1 1 pt. 6,210
  2. Avatar for alyssa_d 132. alyssa_d Lv 1 1 pt. 6,163
  3. Avatar for Palenta 133. Palenta Lv 1 1 pt. 6,085
  4. Avatar for alyssajoyh 134. alyssajoyh Lv 1 1 pt. 5,945
  5. Avatar for toshifumi yui 135. toshifumi yui Lv 1 1 pt. 5,897
  6. Avatar for SaraL 136. SaraL Lv 1 1 pt. 5,773
  7. Avatar for Wendy.E 137. Wendy.E Lv 1 1 pt. 5,329
  8. Avatar for gaving1 139. gaving1 Lv 1 1 pt. 4,005
  9. Avatar for TheStaticSloth 140. TheStaticSloth Lv 1 1 pt. 3,816

Comments