Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Cannabis Crew 11. Cannabis Crew 2 pts. 11,240
  2. Avatar for Team China 12. Team China 1 pt. 11,176
  3. Avatar for Deleted group 13. Deleted group pts. 10,972
  4. Avatar for Androids 14. Androids 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,853
  6. Avatar for freefolder 16. freefolder 1 pt. 10,837
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 10,793
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 10,629
  9. Avatar for Window Group 19. Window Group 1 pt. 7,782

  1. Avatar for Timo van der Laan 100 pts. 11,783
  2. Avatar for smilingone 2. smilingone Lv 1 97 pts. 11,778
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 11,746
  4. Avatar for pauldunn 4. pauldunn Lv 1 91 pts. 11,744
  5. Avatar for LociOiling 5. LociOiling Lv 1 88 pts. 11,732
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 85 pts. 11,725
  7. Avatar for Deleted player 7. Deleted player pts. 11,723
  8. Avatar for bertro 8. bertro Lv 1 80 pts. 11,709
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 77 pts. 11,706
  10. Avatar for Galaxie 10. Galaxie Lv 1 74 pts. 11,694

Comments