Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 2 pts. 11,240
  2. Avatar for Team China 12. Team China 1 pt. 11,176
  3. Avatar for Deleted group 13. Deleted group pts. 10,972
  4. Avatar for Androids 14. Androids 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,853
  6. Avatar for freefolder 16. freefolder 1 pt. 10,837
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 10,793
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 10,629
  9. Avatar for Window Group 19. Window Group 1 pt. 7,782
  1. Avatar for Mao Mao 91. Mao Mao Lv 1 2 pts. 11,203
  2. Avatar for Ladybug_dk 92. Ladybug_dk Lv 1 2 pts. 11,187
  3. Avatar for Kevin76 93. Kevin76 Lv 1 2 pts. 11,176
  4. Avatar for pfirth 94. pfirth Lv 1 1 pt. 11,170
  5. Avatar for anaserra 95. anaserra Lv 1 1 pt. 11,164
  6. Avatar for ourtown 96. ourtown Lv 1 1 pt. 11,137
  7. Avatar for mitarcher 97. mitarcher Lv 1 1 pt. 11,123
  8. Avatar for Arne Heessels 98. Arne Heessels Lv 1 1 pt. 11,114
  9. Avatar for pfeiffelfloyd 99. pfeiffelfloyd Lv 1 1 pt. 11,059
  10. Avatar for TheStaticSloth 100. TheStaticSloth Lv 1 1 pt. 11,048

Comments