Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 2 pts. 11,240
  2. Avatar for Team China 12. Team China 1 pt. 11,176
  3. Avatar for Deleted group 13. Deleted group pts. 10,972
  4. Avatar for Androids 14. Androids 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,853
  6. Avatar for freefolder 16. freefolder 1 pt. 10,837
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 10,793
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 10,629
  9. Avatar for Window Group 19. Window Group 1 pt. 7,782
  1. Avatar for robgee 31. robgee Lv 1 34 pts. 11,589
  2. Avatar for reefyrob 32. reefyrob Lv 1 33 pts. 11,589
  3. Avatar for jausmh 33. jausmh Lv 1 31 pts. 11,586
  4. Avatar for Enzyme 34. Enzyme Lv 1 30 pts. 11,576
  5. Avatar for Neil9 35. Neil9 Lv 1 29 pts. 11,565
  6. Avatar for actiasluna 36. actiasluna Lv 1 28 pts. 11,563
  7. Avatar for christioanchauvin 37. christioanchauvin Lv 1 27 pts. 11,551
  8. Avatar for Norrjane 38. Norrjane Lv 1 26 pts. 11,535
  9. Avatar for katling 39. katling Lv 1 24 pts. 11,532
  10. Avatar for MicElephant 40. MicElephant Lv 1 23 pts. 11,531

Comments