Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 2 pts. 11,240
  2. Avatar for Team China 12. Team China 1 pt. 11,176
  3. Avatar for Deleted group 13. Deleted group pts. 10,972
  4. Avatar for Androids 14. Androids 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,853
  6. Avatar for freefolder 16. freefolder 1 pt. 10,837
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 10,793
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 10,629
  9. Avatar for Window Group 19. Window Group 1 pt. 7,782
  1. Avatar for Glen B 41. Glen B Lv 1 22 pts. 11,529
  2. Avatar for guineapig 42. guineapig Lv 1 22 pts. 11,524
  3. Avatar for YeshuaLives 43. YeshuaLives Lv 1 21 pts. 11,521
  4. Avatar for weitzen 44. weitzen Lv 1 20 pts. 11,520
  5. Avatar for diamonddays 45. diamonddays Lv 1 19 pts. 11,513
  6. Avatar for Grom 46. Grom Lv 1 18 pts. 11,511
  7. Avatar for andrewxc 47. andrewxc Lv 1 17 pts. 11,504
  8. Avatar for petetrig 48. petetrig Lv 1 16 pts. 11,500
  9. Avatar for manu8170 49. manu8170 Lv 1 16 pts. 11,487
  10. Avatar for cobaltteal 50. cobaltteal Lv 1 15 pts. 11,486

Comments