Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 2 pts. 11,240
  2. Avatar for Team China 12. Team China 1 pt. 11,176
  3. Avatar for Deleted group 13. Deleted group pts. 10,972
  4. Avatar for Androids 14. Androids 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,853
  6. Avatar for freefolder 16. freefolder 1 pt. 10,837
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 10,793
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 10,629
  9. Avatar for Window Group 19. Window Group 1 pt. 7,782
  1. Avatar for rezaefar 61. rezaefar Lv 1 9 pts. 11,430
  2. Avatar for alcor29 62. alcor29 Lv 1 8 pts. 11,415
  3. Avatar for Idiotboy 63. Idiotboy Lv 1 8 pts. 11,411
  4. Avatar for alwen 64. alwen Lv 1 8 pts. 11,401
  5. Avatar for TheGUmmer 65. TheGUmmer Lv 1 7 pts. 11,401
  6. Avatar for Museka 66. Museka Lv 1 7 pts. 11,381
  7. Avatar for silent gene 67. silent gene Lv 1 6 pts. 11,369
  8. Avatar for gdnskye 68. gdnskye Lv 1 6 pts. 11,366
  9. Avatar for sciencewalker 69. sciencewalker Lv 1 6 pts. 11,360
  10. Avatar for Crossed Sticks 70. Crossed Sticks Lv 1 5 pts. 11,358

Comments