Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511
  1. Avatar for mirp 11. mirp Lv 1 13 pts. 11,744
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 10 pts. 11,740
  3. Avatar for phi16 13. phi16 Lv 1 7 pts. 11,724
  4. Avatar for alwen 14. alwen Lv 1 6 pts. 11,722
  5. Avatar for lamoille 15. lamoille Lv 1 4 pts. 11,721
  6. Avatar for Deleted player 16. Deleted player pts. 11,712
  7. Avatar for robgee 17. robgee Lv 1 2 pts. 11,711
  8. Avatar for pauldunn 18. pauldunn Lv 1 2 pts. 11,710
  9. Avatar for alcor29 19. alcor29 Lv 1 1 pt. 11,706
  10. Avatar for andrewxc 20. andrewxc Lv 1 1 pt. 11,682

Comments