Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511
  1. Avatar for ManVsYard 21. ManVsYard Lv 1 1 pt. 11,681
  2. Avatar for actiasluna 22. actiasluna Lv 1 1 pt. 11,674
  3. Avatar for Blipperman 23. Blipperman Lv 1 1 pt. 11,610
  4. Avatar for Hollinas 24. Hollinas Lv 1 1 pt. 11,590
  5. Avatar for JMStiffler 25. JMStiffler Lv 1 1 pt. 11,554
  6. Avatar for toshiue 26. toshiue Lv 1 1 pt. 11,495
  7. Avatar for isaksson 27. isaksson Lv 1 1 pt. 11,483
  8. Avatar for ViJay7019 28. ViJay7019 Lv 1 1 pt. 11,446
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 1 pt. 11,425
  10. Avatar for dbuske 30. dbuske Lv 1 1 pt. 11,391

Comments