Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Void Crushers 100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511

  1. Avatar for kludbrook 111. kludbrook Lv 1 1 pt. 10,904
  2. Avatar for momadoc 112. momadoc Lv 1 1 pt. 10,901
  3. Avatar for JackONeill12 113. JackONeill12 Lv 1 1 pt. 10,892
  4. Avatar for larry25427 114. larry25427 Lv 1 1 pt. 10,888
  5. Avatar for RootBeerSwordsman 115. RootBeerSwordsman Lv 1 1 pt. 10,886
  6. Avatar for gstelle 116. gstelle Lv 1 1 pt. 10,873
  7. Avatar for drumpeter18yrs9yrs 117. drumpeter18yrs9yrs Lv 1 1 pt. 10,871
  8. Avatar for rinze 118. rinze Lv 1 1 pt. 10,854
  9. Avatar for 19477619_Schutte 119. 19477619_Schutte Lv 1 1 pt. 10,853
  10. Avatar for parsnip 120. parsnip Lv 1 1 pt. 10,852

Comments