Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Void Crushers 100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511

  1. Avatar for riboseby 121. riboseby Lv 1 1 pt. 10,848
  2. Avatar for Altercomp 122. Altercomp Lv 1 1 pt. 10,837
  3. Avatar for DipsyDoodle2016 123. DipsyDoodle2016 Lv 1 1 pt. 10,811
  4. Avatar for createurprojets 124. createurprojets Lv 1 1 pt. 10,807
  5. Avatar for Anamfija 125. Anamfija Lv 1 1 pt. 10,797
  6. Avatar for brendana0615 126. brendana0615 Lv 1 1 pt. 10,796
  7. Avatar for alyssa_d 127. alyssa_d Lv 1 1 pt. 10,793
  8. Avatar for Sydefecks 128. Sydefecks Lv 1 1 pt. 10,793
  9. Avatar for lith33 129. lith33 Lv 1 1 pt. 10,746
  10. Avatar for khendarg 130. khendarg Lv 1 1 pt. 10,714

Comments