Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Void Crushers 100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511

  1. Avatar for Threeoak 21. Threeoak Lv 1 50 pts. 11,637
  2. Avatar for johnmitch 22. johnmitch Lv 1 48 pts. 11,635
  3. Avatar for Merf 23. Merf Lv 1 47 pts. 11,633
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 45 pts. 11,632
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 43 pts. 11,629
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 41 pts. 11,626
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 40 pts. 11,619
  8. Avatar for crpainter 28. crpainter Lv 1 38 pts. 11,613
  9. Avatar for nicobul 29. nicobul Lv 1 37 pts. 11,603
  10. Avatar for O Seki To 30. O Seki To Lv 1 35 pts. 11,594

Comments