Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Void Crushers 100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511

  1. Avatar for carsonfb 51. carsonfb Lv 1 14 pts. 11,485
  2. Avatar for joremen 52. joremen Lv 1 14 pts. 11,483
  3. Avatar for SaraL 53. SaraL Lv 1 13 pts. 11,479
  4. Avatar for jobo0502 54. jobo0502 Lv 1 12 pts. 11,476
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 11,472
  6. Avatar for Superphosphate 56. Superphosphate Lv 1 11 pts. 11,462
  7. Avatar for cbwest 57. cbwest Lv 1 11 pts. 11,462
  8. Avatar for Alistair69 58. Alistair69 Lv 1 10 pts. 11,458
  9. Avatar for tarimo 59. tarimo Lv 1 10 pts. 11,447
  10. Avatar for altejoh 60. altejoh Lv 1 9 pts. 11,442

Comments