Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511
  1. Avatar for SouperGenious 81. SouperGenious Lv 1 3 pts. 11,273
  2. Avatar for jamiexq 82. jamiexq Lv 1 3 pts. 11,272
  3. Avatar for leehaggis 83. leehaggis Lv 1 3 pts. 11,260
  4. Avatar for DoctorSockrates 84. DoctorSockrates Lv 1 3 pts. 11,259
  5. Avatar for emdee314 85. emdee314 Lv 1 2 pts. 11,257
  6. Avatar for heather-1 86. heather-1 Lv 1 2 pts. 11,252
  7. Avatar for Lord_c_nu 87. Lord_c_nu Lv 1 2 pts. 11,240
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 2 pts. 11,230
  9. Avatar for pandapharmd 89. pandapharmd Lv 1 2 pts. 11,220
  10. Avatar for hada 90. hada Lv 1 2 pts. 11,205

Comments