Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,793
  2. Avatar for Deleted group 12. Deleted group pts. 9,697
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  4. Avatar for freefolder 14. freefolder 1 pt. 9,580
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  6. Avatar for Deleted group 16. Deleted group pts. 9,445
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426
  1. Avatar for bertro
    1. bertro Lv 1
    100 pts. 10,280
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 97 pts. 10,255
  3. Avatar for reefyrob 3. reefyrob Lv 1 94 pts. 10,244
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 91 pts. 10,244
  5. Avatar for johnmitch 5. johnmitch Lv 1 88 pts. 10,235
  6. Avatar for mirp 6. mirp Lv 1 85 pts. 10,229
  7. Avatar for smilingone 7. smilingone Lv 1 82 pts. 10,228
  8. Avatar for grogar7 8. grogar7 Lv 1 80 pts. 10,226
  9. Avatar for LociOiling 9. LociOiling Lv 1 77 pts. 10,225
  10. Avatar for Aubade01 10. Aubade01 Lv 1 75 pts. 10,223

Comments