Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797

  1. Avatar for Galaxie 11. Galaxie Lv 1 10 pts. 10,251
  2. Avatar for pauldunn 12. pauldunn Lv 1 8 pts. 10,248
  3. Avatar for phi16 13. phi16 Lv 1 6 pts. 10,242
  4. Avatar for ManVsYard 14. ManVsYard Lv 1 4 pts. 10,197
  5. Avatar for Deleted player 15. Deleted player pts. 10,196
  6. Avatar for Anfinsen_slept_here 16. Anfinsen_slept_here Lv 1 2 pts. 10,196
  7. Avatar for actiasluna 17. actiasluna Lv 1 2 pts. 10,194
  8. Avatar for robgee 18. robgee Lv 1 1 pt. 10,191
  9. Avatar for Blipperman 19. Blipperman Lv 1 1 pt. 10,185
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 10,176

Comments